PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00022.1.g04180.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 1213aa    MW: 132241 Da    PI: 11.4764
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00022.1.g04180.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC763.8e-2410861130145
                           WRC    1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45  
                                    d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Zjn_sc00022.1.g04180.1.am.mk 1086 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 1130
                                    79****************************************997 PP

2QLQ56.31e-199761011237
                           QLQ    2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37  
                                    +FT+aQ+++L++Q+l+yKyL+a++ vPp+L+++i++
  Zjn_sc00022.1.g04180.1.am.mk  976 PFTPAQFEELEQQALIYKYLVAGVAVPPDLVVPIRR 1011
                                    8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-119751011IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0659761011IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-139761010IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.48610861130IPR014977WRC domain
PfamPF088791.6E-2010871129IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 1213 aa     Download sequence    Send to blast
MRTSLREAQR RKYAATPTPI TCHRARRTSR HLTYSSGSIP PPASSSRPAG AVARLHARDA  60
CATAPRSGAA GPAVRRSRRA RPNLSAHRQQ GRQVDGIPPS DSDRAGNRHG EMPCMHALRD  120
DPFREQVGGL PIGTLTCHLP RCNSSASEHH TWSHWVAMRS RHVIGGPPMR VESGGRRTAA  180
LSHVEGKEGG DDVRDGRWDR PFCVQPSDLD GDELVDARYC LPGFVSCLSC RESHGRGGRG  240
GGRTGLPVGG LCFPSSREPG PVRTARPTRP THAVVRTIPR RRSGSWLLLV GSRGRLQKKQ  300
QNDENHPTGT AYRNRCRACR WGRTLMRDPG FLGMVCGSSS TPTPDDEVAR RQRQLGELGL  360
LAGAKIGKPA PTFAVTCSSC PAKPNHANER KAPPRWIPPP PPRERTGAHG AQCRATGVDA  420
PGTEHRALPL RQVSHGNPGE TENPVAQPCN RIAALLSTPR GTRFSHARID DAWLAAQARK  480
RGSFSFLSFH ALVFFQPLFA RKISAWRRAK AGSPSNADVR SAVCAAPGYA ARSMGGKWKS  540
QQRNPGLASC SARAFFRDRD GTRINSSVRY DKSTATSTVS DRRQLASFEM NSSEGDRRLS  600
HAAVVPWSFV PACTTPVQRD VALLVARFGF RRLERSMRHV SIAYCTCGID GHRNGSDESV  660
AGNCGRSSSV ITVLPLFRKL QLPEMEIAFF SCLASVPGSV SRDLSATSIA AVGGNSFGSD  720
GGNVKEEGKE ATATAPAHPR VAFKSCLGNR NADTAQIHSH LLFHPLSSHA LLVATLPTLL  780
GRREQAQRPR RVGLVHVAPT TNPSLAGGRG ERTTTQRREN PRRAIKAVRA SEPAGEARHL  840
TSQPRTAQRA TQASIQQQNT RGERIKEGEA GRGEHAARER DRRDGDAVCL SFPGRRRRGR  900
RRPPLIHHHH HYHRLAPPLL PRLPALRVSN GGSSRLRLCD LVVVSFARFL VLTSWGSGGG  960
LGEDAQMSGR WARPLPFTPA QFEELEQQAL IYKYLVAGVA VPPDLVVPIR RGLDSLATRF  1020
YGHPTRTVPV LLFYLLLLTT PSLPYRFWRD WVMLSSRLGL WEHVLVVWDW PKISVAYGSY  1080
FGKKLDPEPG RCRRTDGKKW RCSKEAAPDS KYCERHMHRG RNRSRKPVET QLVPQSQPPS  1140
AMAPIAAQPL TAATSGGNFQ SHSLYPAIAG SNGGGEGSNI SSPFTSSLSS SQLNLDNAAT  1200
YAALGGGTGK DLR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369883e-74BT036988.1 Zea mays full-length cDNA clone ZM_BFb0150I14 mRNA, complete cds.
GenBankKJ7279723e-74KJ727972.1 Zea mays clone pUT6086 GRF transcription factor (GRF6) mRNA, partial cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-37growth-regulating factor 5